mat1a antibody Search Results


mat1a antibody (4d11)  (Bio-Techne corporation)
90
Bio-Techne corporation mat1a antibody (4d11)
Mat1a Antibody (4d11), supplied by Bio-Techne corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/mat1a+antibody/bio-techne+corporation___h00004143-m01?v=Bio-Techne+corporation
Average 90 stars, based on 1 article reviews
mat1a antibody (4d11) - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier
mat1a antibody  (Proteintech)
93
Proteintech mat1a antibody
Expression levels of CBS, ALDH2, AHCY, <t>MAT1A</t> and MTHFR proteins in liver tissues of rats in each group. (A) Expression levels of MAT1A protein in liver tissues of rats in each group (n = 3); (B) Expression levels of AHCY protein in liver tissues of rats in each group (n = 3); (C) Expression levels of MYHFR protein in liver tissues of rats in each group (n = 3); (D) Expression levels of ALDH2 protein in liver tissues of rats in each group (n = 3); (E) Expression levels of CBS protein in liver tissues of rats in each group (n = 3). Note: Data are expressed as the mean ± SD. “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.
Mat1a Antibody, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/mat1a+antibody/pmc12815877-65-42-44?v=Proteintech
Average 93 stars, based on 1 article reviews
mat1a antibody - by Bioz Stars, 2026-08
93/100 stars
  Buy from Supplier
mat1a antibody  (Novus Biologicals)
91
Novus Biologicals mat1a antibody
Expression levels of CBS, ALDH2, AHCY, <t>MAT1A</t> and MTHFR proteins in liver tissues of rats in each group. (A) Expression levels of MAT1A protein in liver tissues of rats in each group (n = 3); (B) Expression levels of AHCY protein in liver tissues of rats in each group (n = 3); (C) Expression levels of MYHFR protein in liver tissues of rats in each group (n = 3); (D) Expression levels of ALDH2 protein in liver tissues of rats in each group (n = 3); (E) Expression levels of CBS protein in liver tissues of rats in each group (n = 3). Note: Data are expressed as the mean ± SD. “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.
Mat1a Antibody, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/mat1a+antibody/pmc07400803-65-27-30?v=Novus+Biologicals
Average 91 stars, based on 1 article reviews
mat1a antibody - by Bioz Stars, 2026-08
91/100 stars
  Buy from Supplier
sam synthase  (Novus Biologicals)
91
Novus Biologicals sam synthase
Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; <t>SAM,</t> S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM <t>synthase</t> (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.
Sam Synthase, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/mat1a+antibody/pmc06667456-235-15-19?v=Novus+Biologicals
Average 91 stars, based on 1 article reviews
sam synthase - by Bioz Stars, 2026-08
91/100 stars
  Buy from Supplier
sams 1  (Novus Biologicals)
90
Novus Biologicals sams 1
Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; <t>SAM,</t> S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM <t>synthase</t> (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.
Sams 1, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/mat1a+antibody/pmc04598287-307-18-21?v=Novus+Biologicals
Average 90 stars, based on 1 article reviews
sams 1 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier
mat1a antibody  (Biosynth Carbosynth)
N/A
MAT1A antibody was raised using the N terminal of MAT1A corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE. Rabbit polyclonal MAT1A antibody raised against the N terminal of MAT1A.
   Buy from Supplier
mat1a antibody  (Abbexa)
N/A
MAT1A Antibody is a Rabbit Polyclonal antibody against MAT1A This gene catalyzes a two step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S adenosylmethionine and tripolyphosphate which
   Buy from Supplier
methionine adenosyltransferase i alpha mat1a antibody  (Abbexa)
N/A
Methionine Adenosyltransferase I Alpha MAT1a Antibody is a Mouse Monoclonal antibody against Methionine Adenosyltransferase I Alpha MAT1a
   Buy from Supplier
mat1a antibody (oaec04689)  (Aviva Systems)
N/A
This gene catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylm ethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the
   Buy from Supplier
mat1a antibody  (ProSci Incorporated)
N/A
MAT1A Antibody raised in Rabbit validated in WB in Human, Mouse, Rat.
   Buy from Supplier
mat1a antibody [alexa fluor® 647]  (Novus Biologicals)
N/A
The MAT1A Antibody [Alexa Fluor® 647] from Novus is a MAT1A antibody to MAT1A. This antibody reacts with Human. The MAT1A antibody has been validated for the following applications: Immunohistochemistry-Paraffin.
   Buy from Supplier

Image Search Results


Expression levels of CBS, ALDH2, AHCY, MAT1A and MTHFR proteins in liver tissues of rats in each group. (A) Expression levels of MAT1A protein in liver tissues of rats in each group (n = 3); (B) Expression levels of AHCY protein in liver tissues of rats in each group (n = 3); (C) Expression levels of MYHFR protein in liver tissues of rats in each group (n = 3); (D) Expression levels of ALDH2 protein in liver tissues of rats in each group (n = 3); (E) Expression levels of CBS protein in liver tissues of rats in each group (n = 3). Note: Data are expressed as the mean ± SD. “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.

Journal: Frontiers in Pharmacology

Article Title: Effect of gentiopicroside on endogenous formaldehyde homocysteine–pathway related proteins in rats with non-alcoholic steatohepatitis

doi: 10.3389/fphar.2025.1700101

Figure Lengend Snippet: Expression levels of CBS, ALDH2, AHCY, MAT1A and MTHFR proteins in liver tissues of rats in each group. (A) Expression levels of MAT1A protein in liver tissues of rats in each group (n = 3); (B) Expression levels of AHCY protein in liver tissues of rats in each group (n = 3); (C) Expression levels of MYHFR protein in liver tissues of rats in each group (n = 3); (D) Expression levels of ALDH2 protein in liver tissues of rats in each group (n = 3); (E) Expression levels of CBS protein in liver tissues of rats in each group (n = 3). Note: Data are expressed as the mean ± SD. “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.

Article Snippet: ROS, GSH, MDA, SOD, SAH, SAM, GST, CAT, GSH, HCY were obtained from Jiangsu Enzyme Immunoassay Biotechnology Co., LTD. Their item numbers are MM-88564O1, MM-20251R1, MM-2037H1, MM-20387R1, MM-50456H1, MM-0248H1, MM-21254R1, MM-20447R1, MM-20251R1 and MM-50456H1. β-actin antibody (Proteintech, 20536-1-AP); ALDH2 antibody (Proteintech, 15310-1-AP); MAT1A antibody (Proteintech, 12395-1-AP); MTHFR antibody (Proteintech, 26591-1-AP); CBS antibody (Proteintech, 14787-1-AP); AHCY antibody (Proteintech, 10757-2-AP); PVDF membrane with a thickness of 0.45 μm (IPVH00010, Millipore); Universal total RNA extraction reagent (U7431, Suzhou Youyi Landi Biotechnology Co., LTD.) Taq SYBR® Green qPCR Premix (Universal) (EG0117M, Jiangsu Bishi Mei Biotechnology Co., LTD.) All-in-One First-Strand Synthesis MasterMix (with dsDNase) was obtained from Jiangsu Bestmate Biotechnology Co., LTD. (item number (EG15133S).

Techniques: Expressing

Expression levels of CBS, ALDH2, AHCY, MAT1A and MTHFRmRNA in liver tissues of rats in each group (A) Expression levels of ALDH2 mRNA in liver tissues of rats in each group (n = 3); (B) Expression levels of MTHFRmRNA in liver tissues of rats in each group (n = 3); (C) Expression levels of CBS mRNA in liver tissues of rats in each group (n = 3); (D) Expression levels of AHCY mRNA in liver tissues of rats in each group (n = 3); (E) Expression levels of MAT1A mRNA in liver tissues of rats in each group (n = 3). Note: “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.

Journal: Frontiers in Pharmacology

Article Title: Effect of gentiopicroside on endogenous formaldehyde homocysteine–pathway related proteins in rats with non-alcoholic steatohepatitis

doi: 10.3389/fphar.2025.1700101

Figure Lengend Snippet: Expression levels of CBS, ALDH2, AHCY, MAT1A and MTHFRmRNA in liver tissues of rats in each group (A) Expression levels of ALDH2 mRNA in liver tissues of rats in each group (n = 3); (B) Expression levels of MTHFRmRNA in liver tissues of rats in each group (n = 3); (C) Expression levels of CBS mRNA in liver tissues of rats in each group (n = 3); (D) Expression levels of AHCY mRNA in liver tissues of rats in each group (n = 3); (E) Expression levels of MAT1A mRNA in liver tissues of rats in each group (n = 3). Note: “#” indicates that P < 0.05 compared with the normal group; “*” indicates that P < 0.05 compared with the model group.

Article Snippet: ROS, GSH, MDA, SOD, SAH, SAM, GST, CAT, GSH, HCY were obtained from Jiangsu Enzyme Immunoassay Biotechnology Co., LTD. Their item numbers are MM-88564O1, MM-20251R1, MM-2037H1, MM-20387R1, MM-50456H1, MM-0248H1, MM-21254R1, MM-20447R1, MM-20251R1 and MM-50456H1. β-actin antibody (Proteintech, 20536-1-AP); ALDH2 antibody (Proteintech, 15310-1-AP); MAT1A antibody (Proteintech, 12395-1-AP); MTHFR antibody (Proteintech, 26591-1-AP); CBS antibody (Proteintech, 14787-1-AP); AHCY antibody (Proteintech, 10757-2-AP); PVDF membrane with a thickness of 0.45 μm (IPVH00010, Millipore); Universal total RNA extraction reagent (U7431, Suzhou Youyi Landi Biotechnology Co., LTD.) Taq SYBR® Green qPCR Premix (Universal) (EG0117M, Jiangsu Bishi Mei Biotechnology Co., LTD.) All-in-One First-Strand Synthesis MasterMix (with dsDNase) was obtained from Jiangsu Bestmate Biotechnology Co., LTD. (item number (EG15133S).

Techniques: Expressing

The mechanism diagram of endogenous formaldehyde participating in one-carbon metabolism leading to homocysteine accumulation and causing NASH. Note: formaldehyde (Endogenous FA); Glutathione (GSH) Mitochondrial aldehyde dehydrogenase 2 (ALDH2); Formate; Tetrahydrofolate (THF); 5, 10-methylenetetrahydrofolate (5, 10-CH2-THF); Methylenetetrahydrofolate reductase (MTHFR); Homocysteine (HCY); S-adenosine homocysteine (SAH); Reactive oxygen species (ROS); Non-alcoholic steatohepatitis (NASH); Methionine Cystathionine -β -synthase (CBS); 5-methyltetrahydrofolate (5-CH3-THF); S-adenosylmethionine (SAM); Methionine adenosyltransferase 1A (MAT1A); S-adenosine homocysteine hydrolase (AHCY).

Journal: Frontiers in Pharmacology

Article Title: Effect of gentiopicroside on endogenous formaldehyde homocysteine–pathway related proteins in rats with non-alcoholic steatohepatitis

doi: 10.3389/fphar.2025.1700101

Figure Lengend Snippet: The mechanism diagram of endogenous formaldehyde participating in one-carbon metabolism leading to homocysteine accumulation and causing NASH. Note: formaldehyde (Endogenous FA); Glutathione (GSH) Mitochondrial aldehyde dehydrogenase 2 (ALDH2); Formate; Tetrahydrofolate (THF); 5, 10-methylenetetrahydrofolate (5, 10-CH2-THF); Methylenetetrahydrofolate reductase (MTHFR); Homocysteine (HCY); S-adenosine homocysteine (SAH); Reactive oxygen species (ROS); Non-alcoholic steatohepatitis (NASH); Methionine Cystathionine -β -synthase (CBS); 5-methyltetrahydrofolate (5-CH3-THF); S-adenosylmethionine (SAM); Methionine adenosyltransferase 1A (MAT1A); S-adenosine homocysteine hydrolase (AHCY).

Article Snippet: ROS, GSH, MDA, SOD, SAH, SAM, GST, CAT, GSH, HCY were obtained from Jiangsu Enzyme Immunoassay Biotechnology Co., LTD. Their item numbers are MM-88564O1, MM-20251R1, MM-2037H1, MM-20387R1, MM-50456H1, MM-0248H1, MM-21254R1, MM-20447R1, MM-20251R1 and MM-50456H1. β-actin antibody (Proteintech, 20536-1-AP); ALDH2 antibody (Proteintech, 15310-1-AP); MAT1A antibody (Proteintech, 12395-1-AP); MTHFR antibody (Proteintech, 26591-1-AP); CBS antibody (Proteintech, 14787-1-AP); AHCY antibody (Proteintech, 10757-2-AP); PVDF membrane with a thickness of 0.45 μm (IPVH00010, Millipore); Universal total RNA extraction reagent (U7431, Suzhou Youyi Landi Biotechnology Co., LTD.) Taq SYBR® Green qPCR Premix (Universal) (EG0117M, Jiangsu Bishi Mei Biotechnology Co., LTD.) All-in-One First-Strand Synthesis MasterMix (with dsDNase) was obtained from Jiangsu Bestmate Biotechnology Co., LTD. (item number (EG15133S).

Techniques:

Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; SAM, S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM synthase (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.

Journal: Scientific Reports

Article Title: Unraveling the role of quorum sensing-dependent metabolic homeostasis of the activated methyl cycle in a cooperative population of Burkholderia glumae

doi: 10.1038/s41598-019-47460-6

Figure Lengend Snippet: Regulation of genes involved in the AMC by QS in B . glumae . SAH, S-adenosyl-L-homocysteine; SAM, S -adenosyl- L -methionine; AhcY, SAH hydrolase (gene ID: bglu_1g01990); MetK, SAM synthase (gene ID: bglu_1g33680); MetF, methylenetetrahydrofolate reductase (gene ID: bglu_1g02010); MetE1, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 1 (gene ID: bglu_1g08430); MetE2, 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 2 (gene ID: bglu_2g04930); MetH1, methionine synthase 1 (gene ID: bglu_1g32280); MetH2, methionine synthase 2 (gene ID: bglu_1g32290); octanoyl-ACP, octanoyl acyl-carrier protein; C8-HSL, N -octanoyl homoserine lactone; MetX, homoserine O-acetyltransferase (gene ID: bglu_1g33830); MetZ, O-acetylhomoserine sulfhydrylase (gene ID: bglu_2g08500); MetC, cystathionine beta-lyase (gene ID: bglu_1g15950). T shape indicates inhibition; dashed T indicates putative inhibition. Bold arrows indicate activation, and the asterisk denotes QsmR-dependent expression of metE2 in the absence of MetH1/H2.

Article Snippet: The blocked membrane was incubated with a rabbit polyclonal antibody against the N-terminal region of SAM synthase (MetK; NBP1-55120; Novus Biologicals, LLC, Centennial, CO, USA).

Techniques: Inhibition, Activation Assay, Expressing